Najnovije vesti:
[bsa_pro_ad_space id=3][/bsa_pro_ad_space]

•

“Uspeli smo! Voli vas Boško”

“Uspeli smo! Voli vas Boško”

18/08/2021

Autor: 

Info Press

Izvor: RTS

Foto: RTS

Porodica malog Boška Guglete saopštila je da je prikupljen novac za njegovo lečenje. “Nakon tačno 80 dana sakupljanja sredstava za najskuplju terapiju na svetu, objavljujemo da smo uspeli”, objavila je Boškova porodica na Instagramu.

“Naša sreća je ogromna, a zahvalnost večna. Ne postoje reči kojima bismo mogli da opišemo koliku zahvalnost osećamo. Srećni smo i ponosni što je naš dragi dečak ujedinio sve dobre i humane ljude, sve vas koji ste nam ovu radost omogućili”, navodi se u objavi porodice Boška Guglete na Instagramu.

Porodica se u objavi zahvalila na svakoj donaciji, poslatoj poruci i pozivu, na svakoj objavi na društvenim mrežama i svakom pomenu Boškovog imena. 

“Hvala na svakoj doniranoj stvari, organizovanom bazaru, nagrađivanju, licitacijama, za svaku postavljenu kutiju. Hvala našim malim velikim drugarima iz vrtića, osnovnih i srednjih škola, gimnazijalcima i studentima. Hvala svim kompanijama, svim malim preduzetnicima na svim sjajnim akcijama. Hvala svim medijima i poznatim ličnostima, uz čiju podršku se za Boška čulo širom Srbije i sveta”, navela je Boškova porodica.

Nadaju se da će terapija lekom Zolgensma uskoro biti odobrena u Srbiji i od srca žele da Boško bude poslednje dete koje boluje od spinalne mišićne atrofije za koje su strepeli da li će se dovoljan broj poruka poslati na vreme.

Bošku je spinalna mišićna atrofija dijagnostikovana sredinom maja, za nekoliko dana će otputovati u Budimpeštu, gde bi trebalo da primi sredinom septembra.

, ,

Napišite komentar za ovaj članak

spisak dosadašnjih komentara za ovaj članak

Vaša adresa e-pošte neće biti objavljena. Neophodna polja su označena * zvezdicom.
Info Press zadržava pravo izbora komentara koji će biti objavljeni, kao i pravo skraćivanja komentara.
Komentare koji sadrže govor mržnje, uvrede i psovke, kao i komentare koji se ne odnose na vest, ne objavljujemo.
Spisak dosadašnjih komentara za članak "“Uspeli smo! Voli vas Boško”". 
Podelite vaše mišljenje sa nama. Pošaljite komentar klikom na dugme - napišite komentar.

149 comments on ““Uspeli smo! Voli vas Boško””

  1. Thanks in support of sharing such a good thinking, piece of writing is nice,
    thats why i have read it fully

    Feel free to visit my page :: Sophia

  2. Today, while I was at work, my cousin stole my iPad and tested to see if it can survive a
    40 foot drop, just so she can be a youtube sensation. My iPad is now destroyed and she has 83 views.
    I know this is entirely off topic but I had to share it with
    someone!

    my blog post :: best anti-aging skin care

  4. Thanks for one’s marvelous posting! I truly enjoyed reading it, you might be a great author.
    I will be sure to bookmark your blog and will often come back in the future.

    I want to encourage one to continue your great posts, have a nice day!

    Here is my web blog … medical cannabis

  5. This is really attention-grabbing, You’re an excessively professional blogger.
    I have joined your feed and look ahead to in the hunt for extra of your magnificent
    post. Also, I have shared your site in my social networks!

    Here is my site – hemp seed sprouts (ravenhawksmagickalmysticalplaces.com)

  6. Good post. I learn something new and challenging on websites I stumbleupon everyday.
    It’s always interesting to read content from other authors and practice a little something from other web
    sites.

    Here is my web blog: natural skin care tips for dry skin

  7. I blog often and I genuinely appreciate your information. The
    article has truly peaked my interest. I’m going to book mark your blog and keep checking for new information about once a week.

    I subscribed to your Feed as well.

    Also visit my website – oil pulling teeth whitening (http://23.95.102.216/viewtopic.php?id=332416)

  11. I don’t leave a leave a response, but I read some of the remarks here "Uspeli smo!
    Voli vas Boško". I do have some questions for you if you do not mind.

    Is it just me or does it look as if like some of the comments appear
    as if they are coming from brain dead folks? 😛 And, if you are posting at other online social sites, I’d
    like to keep up with you. Could you list of all of all your
    social networking pages like your linkedin profile,
    Facebook page or twitter feed?

    Also visit my homepage stop smoking weed today

  12. Hey I know this is off topic but I was wondering if
    you knew of any widgets I could add to my blog that
    automatically tweet my newest twitter updates.
    I’ve been looking for a plug-in like this for quite some time and
    was hoping maybe you would have some experience with something like this.

    Please let me know if you run into anything. I truly enjoy reading
    your blog and I look forward to your new updates.

    Look at my web page … skin care methods

  13. Ahaa, its good discussion about this piece of writing at this place at this weblog,
    I have read all that, so at this time me also commenting at this
    place.

    my blog … quit smoking

  16. I’m really loving the theme/design of your blog.
    Do you ever run into any internet browser compatibility problems?

    A small number of my blog audience have complained about my blog not working
    correctly in Explorer but looks great in Safari. Do you have any suggestions to help fix this problem?

    My web site :: adult acne skin care

  17. Whoah this blog is wonderful i love studying your articles.
    Stay up the good work! You already know, many people are
    hunting round for this information, you can help them greatly.

    my site … quality treatment

  18. Hello, you used to write excellent, but the last several posts have been kinda boring…

    I miss your great writings. Past several posts are just
    a little out of track! come on!

    my web blog … skin health

  20. I’m so happy to read this. This is the kind of manual that needs to be given and not the accidental misinformation that
    is at the other blogs. Appreciate moisturize your skin sharing this greatest doc.

  21. Everything is very open coping with eczema a
    precise clarification of the challenges. It was really informative.

    Your site is extremely helpful. Thanks for sharing!

  22. My family always say that I am killing my time here at web, except I know I
    am getting knowledge every day by reading thes fastidious articles.

    Also visit my web page – testosterone therapy

  24. hey there and thank you for your information ?
    I have certainly picked up something new from right here.

    I did however expertise several technical points using this site,
    since I experienced to reload the web site lots of times previous to I could get it to load
    correctly. I had been wondering if your web host is OK?
    Not that I’m complaining, but sluggish loading instances
    times will sometimes affect your placement in google and could damage your high-quality score if advertising and marketing with Adwords.
    Well I’m adding this RSS to my e-mail and can look out for much more of your respective interesting content.
    Make sure you update this again very soon.

    Here is my webpage: muscle tone, http://www.meteoritegarden.com,

  26. This is very interesting, You are an excessively professional blogger.
    I have joined your rss feed and sit up for seeking extra
    of your excellent post. Also, I have shared your website in my
    social networks

    Stop by my web page … prettypeople.club

  27. I’m really enjoying the theme/design of your site. Do you
    ever run into any browser compatibility issues? A number of my blog readers have
    complained about my site not working correctly in Explorer but looks great in Opera.
    Do you have any advice to help fix this issue?

    Feel free to visit my webpage :: flaxseed oil

  28. hello!,I love your writing so so much! proportion we be
    in contact more approximately your article on AOL?
    I need an expert in this area to unravel my problem.

    May be that’s you! Looking forward to look you.

    Review my homepage exclusive protein diet

  29. hello there and thank you for your information ?

    I?ve certainly picked up something new from right here.
    I did however expertise some technical issues using this web
    site, since I experienced to reload the website lots of times previous to
    I could get it to load correctly. I had been wondering if your
    web host is OK? Not that I am complaining, but sluggish loading instances times will often affect your placement in google and could damage your
    quality score if advertising and marketing with Adwords.
    Anyway I am adding this RSS to my e-mail and can look out for much more of your respective exciting content.

    Make sure you update this again very soon..

    My webpage … stop fat gain

  30. Hi my friend! I want to say that this post is amazing, nice written and come with almost
    all significant infos. I would like to look extra posts like this .

    Look into my page; prescription drug abuse

  33. I enjoy what you guys are up too. This kind of clever work and exposure!
    Keep up the good works guys I’ve included you guys to my
    own blogroll.

    Take a look at my blog post http://www.aniene.net

  34. An outstanding share! I have just forwarded this onto a coworker who had been doing a little homework on this.
    And he actually ordered me dinner because I stumbled upon it for him…
    lol. So let me reword this…. Thanks for the meal!! But
    yeah, thanks for spending the time to discuss this issue here on your
    web page.

    Have a look at my web blog: forum.m2clasic.ro

  36. each tips for first time i used to read smaller articles which also clear their
    motive, and that is also happening with this paragraph
    which I am reading at this place.

  37. Good post. I learn something totally new and challenging on sites I stumbleupon everyday.
    It’s always exciting to read content from other authors and practice
    a little something from other sites.

    Also visit my blog meteoritegarden.com

  39. Wow that was unusual. I just wrote an incredibly long comment but
    after I clicked submit my comment didn’t appear. Grrrr… well I’m not writing all that over again. Anyhow, just wanted to say wonderful blog!

    Also visit my web page … Roman

  45. I was very happy to find this great site. I want to to thank you for your time just for this fantastic read!!
    I definitely loved every bit of it and I have you
    book marked to look at new information on your website.

    Take a look at my website … impact carbs

  46. Excellent beat ! I would like to apprentice while you amend your web site, how can i subscribe for a
    blog site? The account aided me a acceptable
    deal. I had been tiny bit acquainted of this
    your broadcast provided bright clear concept

    Look into my web site – http://forum.m2clasic.ro

  47. I love reading and I conceive this website got some really
    utilitarian stuff on it!

    Take a look at my web blog :: seed contains

  48. This is very interesting, You are a very skilled blogger.
    I have joined your rss feed and look forward
    to seeking more of your great post. Also, I’ve shared your website in my social networks!

    Also visit my web blog; Latoya

  50. This is very attention-grabbing, You’re an excessively skilled blogger.
    I have joined your rss feed and look forward
    to looking for more of your wonderful post. Also, I have shared your website in my social networks!

    Also visit my web site … seed sprouts

  52. Hi there! This blog post couldn’t be written any better! Looking through this article reminds me of my previous roommate!
    He constantly kept talking about this. I am going to forward this post to him.
    Fairly certain he’s going to have a very good read.
    Thanks for sharing!

    Feel free to surf to my page; aniene.net

  54. Wow! Thank you! I continuously needed to write on my
    blog something like that. Can I include a part of your post to my
    site?

    Also visit my webpage – 23.95.102.216

  55. Thanks for the marvelous posting! I actually enjoyed reading it, you may be a great author.
    I will be sure to bookmark your blog and will eventually come
    back from now on. I want to encourage you to definitely continue
    your great posts, have a nice weekend!

    Also visit my web page: hemp seed

  56. Today, I went to the beach with my children. I found a sea shell and gave it to my 4 year old daughter and said “You can hear the ocean if you put this to your ear.” She placed the shell to her ear and screamed.
    There was a hermit crab inside and it pinched her
    ear. She never wants to go back! LoL I know this
    is completely off topic but I had to tell someone!

    Also visit my web-site; Gustavo

  57. I really like what you guys are usually up
    too. This type of clever work and coverage! Keep up the wonderful works guys I’ve incorporated
    you guys to my blogroll.

    Here is my website – summer skin care tips

  58. What’s up Dear, are you actually visiting this website regularly, if
    so then you will definitely obtain fastidious knowledge.

    Look at my homepage :: term treatment process

  63. Greetings I am so delighted I found your blog,
    I really found you by error, while I was browsing on Askjeeve for something else, Anyhow I am here now and would just like to say kudos for
    a fantastic post and a all round interesting blog (I also love the theme/design), I don?t have time to browse it
    all at the minute but I have bookmarked it and also added your RSS feeds, so when I have time I will be back
    to read a great deal more, Please do keep up the excellent
    jo.

    my webpage – personal cannabis seeds

  64. Hey there! This is my 1st comment here so I just wanted to give a
    quick shout out and tell you I really enjoy reading
    through your posts. Can you suggest any other blogs/websites/forums
    that cover the same topics? Thanks!

    Feel free to visit my web site; http://23.95.102.216/viewtopic.php?id=362111

  66. I’m really inspired together with your writing talents
    and also with the structure on your blog. Is this a paid topic or did you modify it yourself?
    Either way stay up the excellent high quality writing,
    it’s uncommon to look a great weblog like this one these days..

    Feel free to surf to my webpage – http://39.98.110.214/

  67. Very energetic post, I liked that bit. Will there be a part 2?

    Feel free to visit my webpage; drug use

  68. Thanks for your personal marvelous posting! I seriously enjoyed reading it, you can be a great author.
    I will be sure to bookmark your blog and will often come back later on. I want to encourage one to
    continue your great job, have a nice morning!

    Also visit my blog post hemp oil

  69. Aw, this was a very nice post. Finding the time and actual effort
    to make a great article? but what can I say? I procrastinate
    a whole lot and don’t manage to get nearly anything done.

    My site … bbs.yunweishidai.com

  70. It is the best time to make some plans for the future and
    it’s time to be happy. I have read this post and if I could I want to suggest you some interesting
    things or advice. Maybe you can write next articles referring to this article.
    I desire to read even more things about it!

    Take a look at my site; natural yeast infection treatment

  71. With havin so much written content do you ever run into any issues of plagorism or copyright infringement?
    My site has a lot of exclusive content I’ve either created myself or outsourced
    but it appears a lot of it is popping it up all over the internet without my agreement.
    Do you know any methods to help stop content from being ripped off?

    I’d certainly appreciate it.

    Also visit my blog cannabis seeds

  72. Hi this is kind of of off topic but I was wondering if blogs use WYSIWYG editors or if you have to manually code with HTML.

    I’m starting a blog soon but have no coding know-how so I wanted to get
    guidance from someone with experience. Any help would be greatly appreciated!

    Stop by my page; http://www.comptine.biz

  73. Remarkable things here. I’m very satisfied to see
    your article. Thanks a lot and I am taking a look forward to contact you.

    Will you kindly drop me a e-mail?

    my page :: Brooks

  74. Valuable info. Fortunate me I discovered your website by accident, and I am stunned
    why this coincidence didn’t happened in advance! I bookmarked it.

    Feel free to visit my website – http://www.meteoritegarden.com/

  75. Heya! I just wanted to ask if you ever have any trouble with hackers?
    My last blog (wordpress) was hacked and I ended up losing
    a few months of hard work due to no backup.

    Do you have any solutions to prevent hackers?

    Also visit my webpage … eating program

  77. I’ve learn a few just right stuff here. Certainly worth bookmarking for revisiting.
    I wonder how a lot effort you place to make
    one of these excellent informative site.

    my web-site :: lose fa

  78. magnificent issues altogether, you just gained a new reader.
    What could you suggest in regards to your put up that you made some days in the past?
    Any sure?

    My site … aniene.net

  79. Oh my goodness! Impressive article dude! Thank you, However I am
    having difficulties with your RSS. I don?t know why I am unable to subscribe to
    it. Is there anyone else having the same RSS problems?
    Anybody who knows the solution can you kindly respond? Thanks!!

    My web blog; Meagan

  80. hey there and thank you for your info ? I have definitely picked up something new from right here.
    I did however expertise a few technical issues using this site,
    since I experienced to reload the site many times previous to I could get
    it to load correctly. I had been wondering if your
    web host is OK? Not that I am complaining, but slow loading instances times will
    very frequently affect your placement in google and could damage your high quality score if ads and
    marketing with Adwords. Anyway I am adding this RSS to my e-mail and can look out for a lot more
    of your respective intriguing content. Ensure that you update this again very soon..

    Review my web-site – https://bbs.yunweishidai.com/forum.php?mod=viewthread&tid=2317473

  81. Howdy! Do you know if they make any plugins to safeguard against hackers?

    I’m kinda paranoid about losing everything I’ve worked hard on. Any tips?

    Feel free to surf to my web blog :: promote skin health

  83. Its such as you learn my mind! You appear to know a lot about this, like you wrote the
    e-book in it or something. I think that you simply could do with a few percent to
    force the message home a bit, however other than that,
    that is magnificent blog. An excellent read. I will definitely be back.

    Feel free to visit my webpage … growing cannabis

  85. Very well written article. It will be beneficial to anyone who employess
    it, including yours truly :). Keep up the good work – for sure i will
    check out more posts.

    my webpage … prettypeople.club

  86. I intended to create you a very little note to say thanks a lot yet again just for the
    gorgeous basics you have featured on this website.
    This is tremendously open-handed with you to present unreservedly exactly what many
    individuals could have supplied for an electronic book to end up making some dough for their own end, precisely considering that you could have tried it in the
    event you considered necessary. These good tips also acted like a great way to be
    aware that someone else have a similar fervor really
    like mine to understand a little more in terms of this issue.
    I am sure there are many more pleasurable sessions in the future for folks who look into your blog post.

    Also visit my blog post natural testosterone levels

  87. Keep up the great work, I read few articles on this
    web site and I conceive that your blog is really interesting and has got
    sets of superb info.

    Here is my web site; asmr video right

  88. I’m really impressed along with your writing talents as well as
    with the format on your blog. Is this a paid
    topic or did you modify it your self? Anyway keep up the
    excellent quality writing, it is uncommon to see a great blog like this one these days..

    Also visit my blog post; cannabis license maybe

  89. Pretty! This has been an extremely wonderful post.
    Thanks for supplying these details.

    Here is my web page – fat loss diet

  90. What i do not realize is in fact how you are not really a lot more neatly-liked than you may be now.
    You are very intelligent. You understand thus considerably relating ways to have better sex this matter, made me personally imagine it
    from so many varied angles. Its like men and
    women are not interested unless it is something to accomplish with
    Girl gaga! Your own stuffs great. All the time handle it up!

  91. I do not even know how I ended up here, but I thought this post was great.
    I do not know who you are but definitely you are going to
    a famous blogger if you are not already 😉 Cheers!

    My web-site – forum.m2clasic.ro

  92. Unquestionably believe that which you said. Your favorite justification appeared
    to be on the net the simplest thing to be aware of.
    I say to you, I definitely get irked while people think
    about worries that they plainly don’t know about. You managed to hit the nail
    upon the top and defined out the whole thing without having side-effects
    , people can take a signal. Will probably be back to get
    more. Thanks

    my website – Jill

  96. Whoah this blog is excellent i like studying your articles.

    Stay up the great paintings! You already know, a lot of individuals are looking round for this information, you can help them greatly.

    Feel free to surf to my website; try weed doctor

  97. My partner and I absolutely love your blog and find many of your post’s to be
    just what I’m looking for. Would you offer guest writers to write content in your case?
    I wouldn’t mind writing a post or elaborating on a number of the subjects
    you write about here. Again, awesome website!

    Here is my web site indoor growing

  99. I simply could not go away your web site prior to suggesting that I
    really enjoyed the usual information a person provide on your
    guests? Is gonna be again ceaselessly in order to investigate cross-check new posts

    Feel free to surf to my website – omega 3 source

  100. My partner and I absolutely love your blog and find almost all of your post’s to be what precisely I’m
    looking for. Does one offer guest writers to write content to
    suit your needs? I wouldn’t mind creating a
    post or elaborating on a few of the subjects you
    write related to here. Again, awesome web log!

    My blog hemp farming

  101. Thank you for the auspicious writeup. It in fact was a amusement account it.
    Look advanced to more added agreeable from you!
    By the way, how could we communicate?

    my page; kids smoking

  103. An outstanding share! I have just forwarded this
    onto a co-worker who had been doing a little homework on this.

    And he actually ordered me dinner simply because I stumbled upon it for him…
    lol. So allow me to reword this…. Thank YOU for the meal!!
    But yeah, thanks for spending time to discuss this topic here on your blog.

    Here is my web site; good skin care

  104. Wonderful beat ! I would like to apprentice whilst you amend your web
    site, how can i subscribe for a weblog site? The account aided me a appropriate deal.

    I have been a little bit acquainted of this your broadcast offered bright clear concept

    Here is my page – yizhangbang.net

  105. I’ve been exploring for a bit for any high-quality articles or blog posts on this kind of space .
    Exploring in Yahoo I finally stumbled upon this
    web site. Reading this info So i’m satisfied to express that I have a very
    good uncanny feeling I found out just what I needed.

    I such a lot definitely will make sure to don’t fail to remember
    this website and provides it a glance regularly.

    Here is my web blog – great skin care

  106. Great – I should certainly pronounce, impressed with your site.
    I had no trouble navigating through all the tabs as well as related info ended up being truly
    easy to do to access. I recently found what I
    hoped for before you know it at all. Reasonably unusual.

    Is likely to appreciate it for those who add forums or something,
    website theme . a tones way for your client to communicate.
    Excellent task.

    Feel free to surf to my page: https://bbs.yunweishidai.com

  108. Thanks for the good writeup. It actually was a enjoyment account it.
    Glance complex to more brought agreeable from you! However, how
    could we keep in touch?

    Also visit my web page: 39.98.110.214

  110. Hey! Quick question that’s completely off topic.

    Do you know how to make your site mobile friendly? My blog looks weird when browsing from my iphone4.
    I’m trying to find a theme or plugin that might be
    able to resolve this issue. If you have any suggestions,
    please share. Thank you!

    Look into my web page: cannabis dispensaries-san

  111. Thank you for your blog post. Johnson and I are already saving for
    a new e-book on this subject and your writing has made us all to save all
    of our money. moisturize your skin ideas really clarified all our issues.
    In fact, in excess of what we had acknowledged in advance of the time we ran into your great blog.
    I actually no longer nurture doubts and also a troubled mind because you have attended to the needs in this post.
    Thanks

  112. Hi my loved one! I want to say that this post is awesome,
    nice written and come with approximately all significant infos.
    I would like to peer extra posts like this .

    Also visit my blog post: anti-aging skin care

  113. Whats up very nice web site!! Guy .. Excellent ..
    Wonderful .. I’ll bookmark your web site and take the feeds also…I’m satisfied to
    seek out a lot of helpful information here within the submit, we want develop more strategies on this regard,
    thank you for sharing.

    Here is my blog; carb cycling diet

  114. Heya i’m for the first time here. I came across this board
    and I find It truly useful & it helped me out much.
    I hope to give something back and aid others like you helped
    me.

    My website – try lucid dreaming

  115. Good day! This post couldn’t be written any better!
    Reading this post reminds me of my previous room mate!
    He always kept chatting about this. I will forward this write-up to him.
    Fairly certain he will have a good read. Thank you for sharing!

    Here is my page; acne treatment

  116. Well I definitely liked reading it. This post provided by you is very
    effective for good planning.

    Also visit my page skin cells

  118. Asking questions are really fastidious thing if you are not understanding anything
    completely, however this piece of writing presents pleasant understanding even.

    Review my homepage :: dreaming techniques

  119. I truly love your website.. Very nice colors & theme.
    Did you build this site yourself? Please reply back as I?m wanting to create my very own website and
    want to find out where you got this from or what the theme
    is named. Kudos!

    Here is my web site – https://www.mhes.tyc.edu.tw

  120. Heya i am for the first time here. I found this board and I find It truly useful & it helped me
    out much. I hope to give something back and help others like you helped me.

    Feel free to visit my homepage choosing suitable hair

  122. I am regular visitor, how are you everybody? This piece
    of writing posted at this site is really fastidious.

    My site best skin care

  124. Awesome! Its truly remarkable paragraph, I have got much
    clear idea about from this paragraph.

    My page … quit smoking

  125. Hi, I do believe this is a great website. I stumbledupon it 😉 I may come back
    yet again since i have book marked it. Money and freedom is the best way to change, may you be rich and continue to
    help others.

    my web blog … hgh pills

  126. I and also my guys were actually going through the excellent
    secrets found on your web blog and then immediately came up
    with a horrible feeling I never expressed respect to the blog
    owner for them. These women became thrilled to
    see them and already have undoubtedly been having fun with these things.
    Thank you for simply being really thoughtful and
    also for selecting this sort of superior issues millions of individuals are really eager to be aware of.
    My very own sincere regret for not saying thanks to
    earlier.

    Stop by my web site skin products

  132. Way cool! Some very valid points! I appreciate you penning this write-up plus the rest of the site is extremely good.

    Here is my blog post … 163.30.42.16

  133. Fantastic goods from you, man. I have take into accout your
    stuff prior to and you’re just extremely great. I actually like
    what you’ve obtained here, really like what you’re
    saying and the best way in which you assert it. You’re making
    it entertaining and you still aging skin care for to
    stay it smart. I cant wait to learn much more from you.
    This is really a great web site.

  135. Hi there, You have done a fantastic job. I will certainly digg it and personally suggest to my friends.
    I am sure they’ll be benefited from this web site.

    my blog :: varios-irc.es

  137. Great items from you, man. I’ve understand your
    stuff previous to and you are simply too excellent.
    I actually like what you have acquired here, certainly like what you’re saying and the way in which during which you
    assert it. You’re making it enjoyable and you continue to care for to stay it sensible.
    I can not wait to learn much more from you. That is
    really a wonderful website.

    Feel free to surf to my blog post http://www.aniene.net

  141. Hello, Neat post. There’s a problem with your website in web
    explorer, would test this? IE nonetheless is the marketplace chief and a huge component to
    folks will pass over your great writing due to this problem.

    my webpage: mediterranean diet

  142. Asking questions are really fastidious thing if you are not understanding something
    completely, but this paragraph presents good understanding yet.

    Feel free to surf to my web site :: cannabis vodka

  143. Hi there very cool web site!! Guy .. Excellent
    .. Amazing .. I’ll bookmark your blog and take the feeds additionally?I’m satisfied to find easy diets a lot of useful info right here in the publish, we’d like work out more techniques on this regard,
    thanks for sharing.

  145. At this moment I am ready to do my breakfast,
    when having my breakfast coming yet again to read other news.

    Feel free to surf to my web-site … grow weed

  148. You actually make it seem so easy with your presentation but I find this
    topic to be actually something that I think I would never understand.
    It seems too complicated and very broad for me. I’m looking forward for your
    next post, I’ll try to get the hang of it!

    My web blog – stop sleep talking

  149. Wow, awesome weblog structure! How long have you been running a
    blog for? you made running a blog glance easy.
    The whole glance of your site is great, as well as the content!

    My blog :: bbs.yunweishidai.com

[bsa_pro_ad_space id=1][/bsa_pro_ad_space]

Najnoviji oglasi
Mladi košarkaš Konstantin Karapetrović pred novim izazovima

Konstantin Karapetrović talentovani užički košarkaš je sa nepunih 15 godina otišao u Italiju, kako bi unapredio svoj košarkaški razvoj. Trenutno je na odmoru u svom rodnom gradu i razmišlja gde će nastaviti karijeru.… […]

29/07/2025

Oglasi

Oblačno i hladno vreme, mestimično slaba kiša

oš jedan tmuran decembarski dan u Srbiji. Očekuje se oblačno i hladno vreme, ponegde uz slabu kišu ili rosulu. Na planinama će provejavati slab sneg. Duvaće slab severni vetar.

11/12/2024

Oglasi

Izdaje se radionica za mehaničarske i limarsko-farbarske usluge u Čačku

Izdajem radionicu za mehaničarske usluge sa 4 dizalice u užem centru grada. Izdajem radionicu za limarsko- farbarske usluge sa komorom u užem centru grada. Informacije možete dobiti na: 062/162 1111

30/08/2024

Oglasi

“VINOMANIJA” ZLATIBOR 27.07.2024.GODINE PREZENTACIJA HYUNDAI “TUCSTON” – TERASA I PLATO ISPRED HOTELA PALISAD

Pridružite nam se na Festivalu  “Vinomanija” na Zlatiboru 27. julai otkrite najnovi model Hyundai Tuscona iz 2024. godine

21/07/2024

Oglasi • Privreda

Izdaje se stan kod hotela “Morava” u Čačku

Izdajem stan stan u kvalitetnoj novogradnji kog hotela Morava u Čačku. Stan je kompletno namešten, površine 35 m2. Informacije možete dobiti na: 064/ 148 03 77 064 /510 78 33

28/03/2024

Oglasi

Kliknite ovde za sve oglase

pročitaj još sličnih vesti
Krajnji rok za podnošenje zahteva je 5. februar

Poslednji presek stanja urađen je 18. januara u 19 časova, navode iz RGZ-a

22/01/2026

Društvo

U školama ponovo intenzivne pripreme za završni ispit

Prvi probni završni test biće organizovan 27. i 28. marta.  To  će  biti  prilika  da se   proveri  trenutno znanje učenika i vidi šta može  da  se  poboljša kako  bi  osmaci  u  junu što bolje uradili  test.

22/01/2026

Društvo • Kultura

Produžen rok za ostvarivanje popusta na račun za struju

“Elektroprivreda Srbije” produžila je rok za ostvarivanje popusta od 7 odsto za decembarske račune 24. januara.

22/01/2026

Društvo

Vremenska prognoza za 22. januar 2026. godine

Najniža temperatura od -8 do 1 °S, a najviša dnevna od 0 na severozapadu zemlje i u Negotinskoj Krajini do 8 °S na jugoistoku zemlje

22/01/2026

Društvo

ELEKTRODISTRIBUCIJA UŽICE – REKONSTRUKCIJA DISTRIBUTIVNE MREŽE

Elektrodistribucija Srbije  d. o. o. Beograd kontinuirano radi na unapređenju pouzdanosti i stabilnocti snadbevanja električnom energijom.

21/01/2026

Društvo

Kliknite ovde za sve vesti iz društva
VRATITE SE NA POČETAK STRANE

Impresum  •  Marketing  •  Kontakt informacije  •  Uslovi korišćenja  •  Politika privatnosti  •  Deklaracija o kolačićima  •  Pristup podacima 

2026 © Info Press - Sva prava zadržana. Web design by Real Media Factory

“Uspeli smo! Voli vas Boško”

18/08/2021
Autor:
Info Press
Izvor: RTS
Foto: RTS

Porodica malog Boška Guglete saopštila je da je prikupljen novac za njegovo lečenje. “Nakon tačno 80 dana sakupljanja sredstava za najskuplju terapiju na svetu, objavljujemo da smo uspeli”, objavila je Boškova porodica na Instagramu.

“Naša sreća je ogromna, a zahvalnost večna. Ne postoje reči kojima bismo mogli da opišemo koliku zahvalnost osećamo. Srećni smo i ponosni što je naš dragi dečak ujedinio sve dobre i humane ljude, sve vas koji ste nam ovu radost omogućili”, navodi se u objavi porodice Boška Guglete na Instagramu.

Porodica se u objavi zahvalila na svakoj donaciji, poslatoj poruci i pozivu, na svakoj objavi na društvenim mrežama i svakom pomenu Boškovog imena. 

“Hvala na svakoj doniranoj stvari, organizovanom bazaru, nagrađivanju, licitacijama, za svaku postavljenu kutiju. Hvala našim malim velikim drugarima iz vrtića, osnovnih i srednjih škola, gimnazijalcima i studentima. Hvala svim kompanijama, svim malim preduzetnicima na svim sjajnim akcijama. Hvala svim medijima i poznatim ličnostima, uz čiju podršku se za Boška čulo širom Srbije i sveta”, navela je Boškova porodica.

Nadaju se da će terapija lekom Zolgensma uskoro biti odobrena u Srbiji i od srca žele da Boško bude poslednje dete koje boluje od spinalne mišićne atrofije za koje su strepeli da li će se dovoljan broj poruka poslati na vreme.

Bošku je spinalna mišićna atrofija dijagnostikovana sredinom maja, za nekoliko dana će otputovati u Budimpeštu, gde bi trebalo da primi sredinom septembra.

Napiši komentar

komentari

Vaša adresa e-pošte neće biti objavljena. Neophodna polja su označena * zvezdicom. Info Press zadržava pravo izbora komentara koji će biti objavljeni, kao i pravo skraćivanja komentara. Komentare koji sadrže govor mržnje, uvrede i psovke, kao i komentare koji se ne odnose na vest, ne objavljujemo.
Spisak dosadašnjih komentara za članak "“Uspeli smo! Voli vas Boško”". Podelite vaše mišljenje sa nama. Pošaljite komentar klikom na dugme - napišite komentar.

149 comments on ““Uspeli smo! Voli vas Boško””

  1. Thanks in support of sharing such a good thinking, piece of writing is nice,
    thats why i have read it fully

    Feel free to visit my page :: Sophia

  2. Today, while I was at work, my cousin stole my iPad and tested to see if it can survive a
    40 foot drop, just so she can be a youtube sensation. My iPad is now destroyed and she has 83 views.
    I know this is entirely off topic but I had to share it with
    someone!

    my blog post :: best anti-aging skin care

  4. Thanks for one’s marvelous posting! I truly enjoyed reading it, you might be a great author.
    I will be sure to bookmark your blog and will often come back in the future.

    I want to encourage one to continue your great posts, have a nice day!

    Here is my web blog … medical cannabis

  5. This is really attention-grabbing, You’re an excessively professional blogger.
    I have joined your feed and look ahead to in the hunt for extra of your magnificent
    post. Also, I have shared your site in my social networks!

    Here is my site – hemp seed sprouts (ravenhawksmagickalmysticalplaces.com)

  6. Good post. I learn something new and challenging on websites I stumbleupon everyday.
    It’s always interesting to read content from other authors and practice a little something from other web
    sites.

    Here is my web blog: natural skin care tips for dry skin

  7. I blog often and I genuinely appreciate your information. The
    article has truly peaked my interest. I’m going to book mark your blog and keep checking for new information about once a week.

    I subscribed to your Feed as well.

    Also visit my website – oil pulling teeth whitening (http://23.95.102.216/viewtopic.php?id=332416)

  11. I don’t leave a leave a response, but I read some of the remarks here "Uspeli smo!
    Voli vas Boško". I do have some questions for you if you do not mind.

    Is it just me or does it look as if like some of the comments appear
    as if they are coming from brain dead folks? 😛 And, if you are posting at other online social sites, I’d
    like to keep up with you. Could you list of all of all your
    social networking pages like your linkedin profile,
    Facebook page or twitter feed?

    Also visit my homepage stop smoking weed today

  12. Hey I know this is off topic but I was wondering if
    you knew of any widgets I could add to my blog that
    automatically tweet my newest twitter updates.
    I’ve been looking for a plug-in like this for quite some time and
    was hoping maybe you would have some experience with something like this.

    Please let me know if you run into anything. I truly enjoy reading
    your blog and I look forward to your new updates.

    Look at my web page … skin care methods

  13. Ahaa, its good discussion about this piece of writing at this place at this weblog,
    I have read all that, so at this time me also commenting at this
    place.

    my blog … quit smoking

  16. I’m really loving the theme/design of your blog.
    Do you ever run into any internet browser compatibility problems?

    A small number of my blog audience have complained about my blog not working
    correctly in Explorer but looks great in Safari. Do you have any suggestions to help fix this problem?

    My web site :: adult acne skin care

  17. Whoah this blog is wonderful i love studying your articles.
    Stay up the good work! You already know, many people are
    hunting round for this information, you can help them greatly.

    my site … quality treatment

  18. Hello, you used to write excellent, but the last several posts have been kinda boring…

    I miss your great writings. Past several posts are just
    a little out of track! come on!

    my web blog … skin health

  20. I’m so happy to read this. This is the kind of manual that needs to be given and not the accidental misinformation that
    is at the other blogs. Appreciate moisturize your skin sharing this greatest doc.

  21. Everything is very open coping with eczema a
    precise clarification of the challenges. It was really informative.

    Your site is extremely helpful. Thanks for sharing!

  22. My family always say that I am killing my time here at web, except I know I
    am getting knowledge every day by reading thes fastidious articles.

    Also visit my web page – testosterone therapy

  24. hey there and thank you for your information ?
    I have certainly picked up something new from right here.

    I did however expertise several technical points using this site,
    since I experienced to reload the web site lots of times previous to I could get it to load
    correctly. I had been wondering if your web host is OK?
    Not that I’m complaining, but sluggish loading instances
    times will sometimes affect your placement in google and could damage your high-quality score if advertising and marketing with Adwords.
    Well I’m adding this RSS to my e-mail and can look out for much more of your respective interesting content.
    Make sure you update this again very soon.

    Here is my webpage: muscle tone, http://www.meteoritegarden.com,

  26. This is very interesting, You are an excessively professional blogger.
    I have joined your rss feed and sit up for seeking extra
    of your excellent post. Also, I have shared your website in my
    social networks

    Stop by my web page … prettypeople.club

  27. I’m really enjoying the theme/design of your site. Do you
    ever run into any browser compatibility issues? A number of my blog readers have
    complained about my site not working correctly in Explorer but looks great in Opera.
    Do you have any advice to help fix this issue?

    Feel free to visit my webpage :: flaxseed oil

  28. hello!,I love your writing so so much! proportion we be
    in contact more approximately your article on AOL?
    I need an expert in this area to unravel my problem.

    May be that’s you! Looking forward to look you.

    Review my homepage exclusive protein diet

  29. hello there and thank you for your information ?

    I?ve certainly picked up something new from right here.
    I did however expertise some technical issues using this web
    site, since I experienced to reload the website lots of times previous to
    I could get it to load correctly. I had been wondering if your
    web host is OK? Not that I am complaining, but sluggish loading instances times will often affect your placement in google and could damage your
    quality score if advertising and marketing with Adwords.
    Anyway I am adding this RSS to my e-mail and can look out for much more of your respective exciting content.

    Make sure you update this again very soon..

    My webpage … stop fat gain

  30. Hi my friend! I want to say that this post is amazing, nice written and come with almost
    all significant infos. I would like to look extra posts like this .

    Look into my page; prescription drug abuse

  33. I enjoy what you guys are up too. This kind of clever work and exposure!
    Keep up the good works guys I’ve included you guys to my
    own blogroll.

    Take a look at my blog post http://www.aniene.net

  34. An outstanding share! I have just forwarded this onto a coworker who had been doing a little homework on this.
    And he actually ordered me dinner because I stumbled upon it for him…
    lol. So let me reword this…. Thanks for the meal!! But
    yeah, thanks for spending the time to discuss this issue here on your
    web page.

    Have a look at my web blog: forum.m2clasic.ro

  36. each tips for first time i used to read smaller articles which also clear their
    motive, and that is also happening with this paragraph
    which I am reading at this place.

  37. Good post. I learn something totally new and challenging on sites I stumbleupon everyday.
    It’s always exciting to read content from other authors and practice
    a little something from other sites.

    Also visit my blog meteoritegarden.com

  39. Wow that was unusual. I just wrote an incredibly long comment but
    after I clicked submit my comment didn’t appear. Grrrr… well I’m not writing all that over again. Anyhow, just wanted to say wonderful blog!

    Also visit my web page … Roman

  45. I was very happy to find this great site. I want to to thank you for your time just for this fantastic read!!
    I definitely loved every bit of it and I have you
    book marked to look at new information on your website.

    Take a look at my website … impact carbs

  46. Excellent beat ! I would like to apprentice while you amend your web site, how can i subscribe for a
    blog site? The account aided me a acceptable
    deal. I had been tiny bit acquainted of this
    your broadcast provided bright clear concept

    Look into my web site – http://forum.m2clasic.ro

  47. I love reading and I conceive this website got some really
    utilitarian stuff on it!

    Take a look at my web blog :: seed contains

  48. This is very interesting, You are a very skilled blogger.
    I have joined your rss feed and look forward
    to seeking more of your great post. Also, I’ve shared your website in my social networks!

    Also visit my web blog; Latoya

  50. This is very attention-grabbing, You’re an excessively skilled blogger.
    I have joined your rss feed and look forward
    to looking for more of your wonderful post. Also, I have shared your website in my social networks!

    Also visit my web site … seed sprouts

  52. Hi there! This blog post couldn’t be written any better! Looking through this article reminds me of my previous roommate!
    He constantly kept talking about this. I am going to forward this post to him.
    Fairly certain he’s going to have a very good read.
    Thanks for sharing!

    Feel free to surf to my page; aniene.net

  54. Wow! Thank you! I continuously needed to write on my
    blog something like that. Can I include a part of your post to my
    site?

    Also visit my webpage – 23.95.102.216

  55. Thanks for the marvelous posting! I actually enjoyed reading it, you may be a great author.
    I will be sure to bookmark your blog and will eventually come
    back from now on. I want to encourage you to definitely continue
    your great posts, have a nice weekend!

    Also visit my web page: hemp seed

  56. Today, I went to the beach with my children. I found a sea shell and gave it to my 4 year old daughter and said “You can hear the ocean if you put this to your ear.” She placed the shell to her ear and screamed.
    There was a hermit crab inside and it pinched her
    ear. She never wants to go back! LoL I know this
    is completely off topic but I had to tell someone!

    Also visit my web-site; Gustavo

  57. I really like what you guys are usually up
    too. This type of clever work and coverage! Keep up the wonderful works guys I’ve incorporated
    you guys to my blogroll.

    Here is my website – summer skin care tips

  58. What’s up Dear, are you actually visiting this website regularly, if
    so then you will definitely obtain fastidious knowledge.

    Look at my homepage :: term treatment process

  63. Greetings I am so delighted I found your blog,
    I really found you by error, while I was browsing on Askjeeve for something else, Anyhow I am here now and would just like to say kudos for
    a fantastic post and a all round interesting blog (I also love the theme/design), I don?t have time to browse it
    all at the minute but I have bookmarked it and also added your RSS feeds, so when I have time I will be back
    to read a great deal more, Please do keep up the excellent
    jo.

    my webpage – personal cannabis seeds

  64. Hey there! This is my 1st comment here so I just wanted to give a
    quick shout out and tell you I really enjoy reading
    through your posts. Can you suggest any other blogs/websites/forums
    that cover the same topics? Thanks!

    Feel free to visit my web site; http://23.95.102.216/viewtopic.php?id=362111

  66. I’m really inspired together with your writing talents
    and also with the structure on your blog. Is this a paid topic or did you modify it yourself?
    Either way stay up the excellent high quality writing,
    it’s uncommon to look a great weblog like this one these days..

    Feel free to surf to my webpage – http://39.98.110.214/

  67. Very energetic post, I liked that bit. Will there be a part 2?

    Feel free to visit my webpage; drug use

  68. Thanks for your personal marvelous posting! I seriously enjoyed reading it, you can be a great author.
    I will be sure to bookmark your blog and will often come back later on. I want to encourage one to
    continue your great job, have a nice morning!

    Also visit my blog post hemp oil

  69. Aw, this was a very nice post. Finding the time and actual effort
    to make a great article? but what can I say? I procrastinate
    a whole lot and don’t manage to get nearly anything done.

    My site … bbs.yunweishidai.com

  70. It is the best time to make some plans for the future and
    it’s time to be happy. I have read this post and if I could I want to suggest you some interesting
    things or advice. Maybe you can write next articles referring to this article.
    I desire to read even more things about it!

    Take a look at my site; natural yeast infection treatment

  71. With havin so much written content do you ever run into any issues of plagorism or copyright infringement?
    My site has a lot of exclusive content I’ve either created myself or outsourced
    but it appears a lot of it is popping it up all over the internet without my agreement.
    Do you know any methods to help stop content from being ripped off?

    I’d certainly appreciate it.

    Also visit my blog cannabis seeds

  72. Hi this is kind of of off topic but I was wondering if blogs use WYSIWYG editors or if you have to manually code with HTML.

    I’m starting a blog soon but have no coding know-how so I wanted to get
    guidance from someone with experience. Any help would be greatly appreciated!

    Stop by my page; http://www.comptine.biz

  73. Remarkable things here. I’m very satisfied to see
    your article. Thanks a lot and I am taking a look forward to contact you.

    Will you kindly drop me a e-mail?

    my page :: Brooks

  74. Valuable info. Fortunate me I discovered your website by accident, and I am stunned
    why this coincidence didn’t happened in advance! I bookmarked it.

    Feel free to visit my website – http://www.meteoritegarden.com/

  75. Heya! I just wanted to ask if you ever have any trouble with hackers?
    My last blog (wordpress) was hacked and I ended up losing
    a few months of hard work due to no backup.

    Do you have any solutions to prevent hackers?

    Also visit my webpage … eating program

  77. I’ve learn a few just right stuff here. Certainly worth bookmarking for revisiting.
    I wonder how a lot effort you place to make
    one of these excellent informative site.

    my web-site :: lose fa

  78. magnificent issues altogether, you just gained a new reader.
    What could you suggest in regards to your put up that you made some days in the past?
    Any sure?

    My site … aniene.net

  79. Oh my goodness! Impressive article dude! Thank you, However I am
    having difficulties with your RSS. I don?t know why I am unable to subscribe to
    it. Is there anyone else having the same RSS problems?
    Anybody who knows the solution can you kindly respond? Thanks!!

    My web blog; Meagan

  80. hey there and thank you for your info ? I have definitely picked up something new from right here.
    I did however expertise a few technical issues using this site,
    since I experienced to reload the site many times previous to I could get
    it to load correctly. I had been wondering if your
    web host is OK? Not that I am complaining, but slow loading instances times will
    very frequently affect your placement in google and could damage your high quality score if ads and
    marketing with Adwords. Anyway I am adding this RSS to my e-mail and can look out for a lot more
    of your respective intriguing content. Ensure that you update this again very soon..

    Review my web-site – https://bbs.yunweishidai.com/forum.php?mod=viewthread&tid=2317473

  81. Howdy! Do you know if they make any plugins to safeguard against hackers?

    I’m kinda paranoid about losing everything I’ve worked hard on. Any tips?

    Feel free to surf to my web blog :: promote skin health

  83. Its such as you learn my mind! You appear to know a lot about this, like you wrote the
    e-book in it or something. I think that you simply could do with a few percent to
    force the message home a bit, however other than that,
    that is magnificent blog. An excellent read. I will definitely be back.

    Feel free to visit my webpage … growing cannabis

  85. Very well written article. It will be beneficial to anyone who employess
    it, including yours truly :). Keep up the good work – for sure i will
    check out more posts.

    my webpage … prettypeople.club

  86. I intended to create you a very little note to say thanks a lot yet again just for the
    gorgeous basics you have featured on this website.
    This is tremendously open-handed with you to present unreservedly exactly what many
    individuals could have supplied for an electronic book to end up making some dough for their own end, precisely considering that you could have tried it in the
    event you considered necessary. These good tips also acted like a great way to be
    aware that someone else have a similar fervor really
    like mine to understand a little more in terms of this issue.
    I am sure there are many more pleasurable sessions in the future for folks who look into your blog post.

    Also visit my blog post natural testosterone levels

  87. Keep up the great work, I read few articles on this
    web site and I conceive that your blog is really interesting and has got
    sets of superb info.

    Here is my web site; asmr video right

  88. I’m really impressed along with your writing talents as well as
    with the format on your blog. Is this a paid
    topic or did you modify it your self? Anyway keep up the
    excellent quality writing, it is uncommon to see a great blog like this one these days..

    Also visit my blog post; cannabis license maybe

  89. Pretty! This has been an extremely wonderful post.
    Thanks for supplying these details.

    Here is my web page – fat loss diet

  90. What i do not realize is in fact how you are not really a lot more neatly-liked than you may be now.
    You are very intelligent. You understand thus considerably relating ways to have better sex this matter, made me personally imagine it
    from so many varied angles. Its like men and
    women are not interested unless it is something to accomplish with
    Girl gaga! Your own stuffs great. All the time handle it up!

  91. I do not even know how I ended up here, but I thought this post was great.
    I do not know who you are but definitely you are going to
    a famous blogger if you are not already 😉 Cheers!

    My web-site – forum.m2clasic.ro

  92. Unquestionably believe that which you said. Your favorite justification appeared
    to be on the net the simplest thing to be aware of.
    I say to you, I definitely get irked while people think
    about worries that they plainly don’t know about. You managed to hit the nail
    upon the top and defined out the whole thing without having side-effects
    , people can take a signal. Will probably be back to get
    more. Thanks

    my website – Jill

  96. Whoah this blog is excellent i like studying your articles.

    Stay up the great paintings! You already know, a lot of individuals are looking round for this information, you can help them greatly.

    Feel free to surf to my website; try weed doctor

  97. My partner and I absolutely love your blog and find many of your post’s to be
    just what I’m looking for. Would you offer guest writers to write content in your case?
    I wouldn’t mind writing a post or elaborating on a number of the subjects
    you write about here. Again, awesome website!

    Here is my web site indoor growing

  99. I simply could not go away your web site prior to suggesting that I
    really enjoyed the usual information a person provide on your
    guests? Is gonna be again ceaselessly in order to investigate cross-check new posts

    Feel free to surf to my website – omega 3 source

  100. My partner and I absolutely love your blog and find almost all of your post’s to be what precisely I’m
    looking for. Does one offer guest writers to write content to
    suit your needs? I wouldn’t mind creating a
    post or elaborating on a few of the subjects you
    write related to here. Again, awesome web log!

    My blog hemp farming

  101. Thank you for the auspicious writeup. It in fact was a amusement account it.
    Look advanced to more added agreeable from you!
    By the way, how could we communicate?

    my page; kids smoking

  103. An outstanding share! I have just forwarded this
    onto a co-worker who had been doing a little homework on this.

    And he actually ordered me dinner simply because I stumbled upon it for him…
    lol. So allow me to reword this…. Thank YOU for the meal!!
    But yeah, thanks for spending time to discuss this topic here on your blog.

    Here is my web site; good skin care

  104. Wonderful beat ! I would like to apprentice whilst you amend your web
    site, how can i subscribe for a weblog site? The account aided me a appropriate deal.

    I have been a little bit acquainted of this your broadcast offered bright clear concept

    Here is my page – yizhangbang.net

  105. I’ve been exploring for a bit for any high-quality articles or blog posts on this kind of space .
    Exploring in Yahoo I finally stumbled upon this
    web site. Reading this info So i’m satisfied to express that I have a very
    good uncanny feeling I found out just what I needed.

    I such a lot definitely will make sure to don’t fail to remember
    this website and provides it a glance regularly.

    Here is my web blog – great skin care

  106. Great – I should certainly pronounce, impressed with your site.
    I had no trouble navigating through all the tabs as well as related info ended up being truly
    easy to do to access. I recently found what I
    hoped for before you know it at all. Reasonably unusual.

    Is likely to appreciate it for those who add forums or something,
    website theme . a tones way for your client to communicate.
    Excellent task.

    Feel free to surf to my page: https://bbs.yunweishidai.com

  108. Thanks for the good writeup. It actually was a enjoyment account it.
    Glance complex to more brought agreeable from you! However, how
    could we keep in touch?

    Also visit my web page: 39.98.110.214

  110. Hey! Quick question that’s completely off topic.

    Do you know how to make your site mobile friendly? My blog looks weird when browsing from my iphone4.
    I’m trying to find a theme or plugin that might be
    able to resolve this issue. If you have any suggestions,
    please share. Thank you!

    Look into my web page: cannabis dispensaries-san

  111. Thank you for your blog post. Johnson and I are already saving for
    a new e-book on this subject and your writing has made us all to save all
    of our money. moisturize your skin ideas really clarified all our issues.
    In fact, in excess of what we had acknowledged in advance of the time we ran into your great blog.
    I actually no longer nurture doubts and also a troubled mind because you have attended to the needs in this post.
    Thanks

  112. Hi my loved one! I want to say that this post is awesome,
    nice written and come with approximately all significant infos.
    I would like to peer extra posts like this .

    Also visit my blog post: anti-aging skin care

  113. Whats up very nice web site!! Guy .. Excellent ..
    Wonderful .. I’ll bookmark your web site and take the feeds also…I’m satisfied to
    seek out a lot of helpful information here within the submit, we want develop more strategies on this regard,
    thank you for sharing.

    Here is my blog; carb cycling diet

  114. Heya i’m for the first time here. I came across this board
    and I find It truly useful & it helped me out much.
    I hope to give something back and aid others like you helped
    me.

    My website – try lucid dreaming

  115. Good day! This post couldn’t be written any better!
    Reading this post reminds me of my previous room mate!
    He always kept chatting about this. I will forward this write-up to him.
    Fairly certain he will have a good read. Thank you for sharing!

    Here is my page; acne treatment

  116. Well I definitely liked reading it. This post provided by you is very
    effective for good planning.

    Also visit my page skin cells

  118. Asking questions are really fastidious thing if you are not understanding anything
    completely, however this piece of writing presents pleasant understanding even.

    Review my homepage :: dreaming techniques

  119. I truly love your website.. Very nice colors & theme.
    Did you build this site yourself? Please reply back as I?m wanting to create my very own website and
    want to find out where you got this from or what the theme
    is named. Kudos!

    Here is my web site – https://www.mhes.tyc.edu.tw

  120. Heya i am for the first time here. I found this board and I find It truly useful & it helped me
    out much. I hope to give something back and help others like you helped me.

    Feel free to visit my homepage choosing suitable hair

  122. I am regular visitor, how are you everybody? This piece
    of writing posted at this site is really fastidious.

    My site best skin care

  124. Awesome! Its truly remarkable paragraph, I have got much
    clear idea about from this paragraph.

    My page … quit smoking

  125. Hi, I do believe this is a great website. I stumbledupon it 😉 I may come back
    yet again since i have book marked it. Money and freedom is the best way to change, may you be rich and continue to
    help others.

    my web blog … hgh pills

  126. I and also my guys were actually going through the excellent
    secrets found on your web blog and then immediately came up
    with a horrible feeling I never expressed respect to the blog
    owner for them. These women became thrilled to
    see them and already have undoubtedly been having fun with these things.
    Thank you for simply being really thoughtful and
    also for selecting this sort of superior issues millions of individuals are really eager to be aware of.
    My very own sincere regret for not saying thanks to
    earlier.

    Stop by my web site skin products

  132. Way cool! Some very valid points! I appreciate you penning this write-up plus the rest of the site is extremely good.

    Here is my blog post … 163.30.42.16

  133. Fantastic goods from you, man. I have take into accout your
    stuff prior to and you’re just extremely great. I actually like
    what you’ve obtained here, really like what you’re
    saying and the best way in which you assert it. You’re making
    it entertaining and you still aging skin care for to
    stay it smart. I cant wait to learn much more from you.
    This is really a great web site.

  135. Hi there, You have done a fantastic job. I will certainly digg it and personally suggest to my friends.
    I am sure they’ll be benefited from this web site.

    my blog :: varios-irc.es

  137. Great items from you, man. I’ve understand your
    stuff previous to and you are simply too excellent.
    I actually like what you have acquired here, certainly like what you’re saying and the way in which during which you
    assert it. You’re making it enjoyable and you continue to care for to stay it sensible.
    I can not wait to learn much more from you. That is
    really a wonderful website.

    Feel free to surf to my blog post http://www.aniene.net

  141. Hello, Neat post. There’s a problem with your website in web
    explorer, would test this? IE nonetheless is the marketplace chief and a huge component to
    folks will pass over your great writing due to this problem.

    my webpage: mediterranean diet

  142. Asking questions are really fastidious thing if you are not understanding something
    completely, but this paragraph presents good understanding yet.

    Feel free to surf to my web site :: cannabis vodka

  143. Hi there very cool web site!! Guy .. Excellent
    .. Amazing .. I’ll bookmark your blog and take the feeds additionally?I’m satisfied to find easy diets a lot of useful info right here in the publish, we’d like work out more techniques on this regard,
    thanks for sharing.

  145. At this moment I am ready to do my breakfast,
    when having my breakfast coming yet again to read other news.

    Feel free to surf to my web-site … grow weed

  148. You actually make it seem so easy with your presentation but I find this
    topic to be actually something that I think I would never understand.
    It seems too complicated and very broad for me. I’m looking forward for your
    next post, I’ll try to get the hang of it!

    My web blog – stop sleep talking

  149. Wow, awesome weblog structure! How long have you been running a
    blog for? you made running a blog glance easy.
    The whole glance of your site is great, as well as the content!

    My blog :: bbs.yunweishidai.com

[bsa_pro_ad_space id=9][/bsa_pro_ad_space]

Najnoviji oglasi

Mladi košarkaš Konstantin Karapetrović pred novim izazovima

Konstantin Karapetrović talentovani užički košarkaš je sa nepunih 15 godina otišao u Italiju, kako bi unapredio svoj košarkaški razvoj. Trenutno je na odmoru u svom rodnom gradu i razmišlja gde će nastaviti karijeru.… […]

29/07/2025

Oglasi

Oblačno i hladno vreme, mestimično slaba kiša

oš jedan tmuran decembarski dan u Srbiji. Očekuje se oblačno i hladno vreme, ponegde uz slabu kišu ili rosulu. Na planinama će provejavati slab sneg. Duvaće slab severni vetar.

11/12/2024

Oglasi

Izdaje se radionica za mehaničarske i limarsko-farbarske usluge u Čačku

Izdajem radionicu za mehaničarske usluge sa 4 dizalice u užem centru grada. Izdajem radionicu za limarsko- farbarske usluge sa komorom u užem centru grada. Informacije možete dobiti na: 062/162 1111

30/08/2024

Oglasi

Pogledaj sve oglase

Pročitaj slične vesti

Krajnji rok za podnošenje zahteva je 5. februar

Poslednji presek stanja urađen je 18. januara u 19 časova, navode iz RGZ-a

22/01/2026

Društvo

U školama ponovo intenzivne pripreme za završni ispit

Prvi probni završni test biće organizovan 27. i 28. marta.  To  će  biti  prilika  da se   proveri  trenutno znanje učenika i vidi šta može  da  se  poboljša kako  bi  osmaci  u  junu što bolje uradili  test.

22/01/2026

Društvo • Kultura

Produžen rok za ostvarivanje popusta na račun za struju

“Elektroprivreda Srbije” produžila je rok za ostvarivanje popusta od 7 odsto za decembarske račune 24. januara.

22/01/2026

Društvo

Pogledaj sve vesti

pretraži sajt

[bsa_pro_ad_space id=9][/bsa_pro_ad_space]

Zapratite nas na fejsbuku

redakcija@infopress.rs

Marketing@infopress.rs

VRATITE SE NA POČETAK STRANE
O privatnosti

Ovaj web sajt koristi kolačiće kako bi izvršavao određene funkcionalnosti, te radi analize poseta i prilagođavanja sadržaja. Načini prikupljanja, obrade i upravljanja ličnim podacima, definisani su dokumentom Politika privatnosti.